PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013628926.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 555aa    MW: 61584.4 Da    PI: 7.0774
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013628926.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-142976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ede+l+ +v++ G g+W++  ++  + R++k+c++rw ++l
   XP_013628926.1 29 KGPWTAAEDEILAAYVRENGEGNWNSLQKHTCLARCGKSCRLRWANHL 76
                     79******************************************9986 PP

2Myb_DNA-binding46.49.3e-1582125146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T +E+ l++++++qlG++ W++ a+ ++ gRt++++k++w++
   XP_013628926.1  82 KGSFTGDEERLIIQLHAQLGNK-WARMAAQLP-GRTDNEIKNYWNT 125
                      789*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.2632476IPR017930Myb domain
SuperFamilySSF466891.05E-2727123IPR009057Homeodomain-like
SMARTSM007171.4E-112878IPR001005SANT/Myb domain
PfamPF002494.9E-132976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-213083IPR009057Homeodomain-like
CDDcd001671.61E-93176No hitNo description
PROSITE profilePS5129424.47877131IPR017930Myb domain
SMARTSM007172.5E-1581129IPR001005SANT/Myb domain
PfamPF002491.8E-1382125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2484129IPR009057Homeodomain-like
CDDcd001678.91E-1184127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MILYGVGTGN DGGSTNHISD GGGRVALKKG PWTAAEDEIL AAYVRENGEG NWNSLQKHTC  60
LARCGKSCRL RWANHLRPNL KKGSFTGDEE RLIIQLHAQL GNKWARMAAQ LPGRTDNEIK  120
NYWNTRLKRL QRQGLPLYPP DVIPNHQLHP HPQHHHHQQH QQMYFHPHSS QPNTPSSSPL  180
PSPTPVNANP SSSFTFHTTN ASTANLLHPL SPHTPTTPQT PSQLSSRPPP QPLSSPLSSP  240
LNNQYPTLPL FNNNNNNTNF TFPRPPPLLQ PPSSLFARRY NNSNTPLNYT NRVSTAPFTP  300
VSRDSYTSFL TLPYSSSAAP NTRPITYHNT NNNYSSFSLN PSSSSYPTTT SSPSFLHSHY  360
TPNSSSTSFH TNPVYTMKQD LPSNQIPQIC AFNNVNNFTD NEKGLHRRSI SCSLLEDVME  420
EAEAVDGGGG GRPPKRRQLT YSPLNNQHNN NNNNHNDFFS VTFGQYDSSE NICSLQDLKP  480
KEGESLEMNT MQDDIAKLLD WGSDSGEISN GQSSAVTDEN LVLDVHQFAS LFPADSTAAA  540
NDNNDNNNFS WDDLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-30271292103C-Myb DNA-Binding Domain
1msf_C5e-30271292103C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1431436RPPKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893030.0AC189303.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB030F12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628926.10.0PREDICTED: myb-like protein A
TrEMBLA0A0D3B3F00.0A0A0D3B3F0_BRAOL; Uncharacterized protein
STRINGBra028997.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99391934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55020.11e-81myb domain protein 120